PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA03G20120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 434aa    MW: 46008.3 Da    PI: 8.1996
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA03G20120.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.66.5e-3988147261
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      ++k+l+cprC s++tkfCy+nny+++qPr+fCk C+ryWt+GGa+rnvPvG+grrknk++
  ONIVA03G20120.1  88 PDKILPCPRCSSMDTKFCYFNNYNVNQPRHFCKHCQRYWTAGGAMRNVPVGAGRRKNKNA 147
                      7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3875145IPR003851Zinc finger, Dof-type
PfamPF027011.3E-3190146IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.57492146IPR003851Zinc finger, Dof-type
PROSITE patternPS01361094130IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MGECRGGGDG LIKLFGKTIP VQPDAKDVQQ HSGSSSSSTE SDVQETAAVA VADPSPRSEV  60
VDGESPPQPG GEAASHQQQQ KEMKLKKPDK ILPCPRCSSM DTKFCYFNNY NVNQPRHFCK  120
HCQRYWTAGG AMRNVPVGAG RRKNKNATAA AHFLHRVRAC AAAAAMPAAP HDATNATVLS  180
FGGGGGGHDA LPVTLDLADK MTRLGKEGLV AHARNADAAA ACSEVSSNRD DEQIGNTVAK  240
PANGLQQHPP PPHHHHHSAM NGGGIWPYYT SGIAIPIYPA APAYWGCMIP PPGAWSLPWP  300
ATVQSQAISS SSPPTSATPS VSSFTLGKHP REGGDHEARD HHGNGKVWVP KTIRIDNADE  360
VARSSIRSLF AFRGGDKVDD NNDDDGTSVH KLATTVFEPK RDGKTAKHPA ITSLPLLHTN  420
PVALTRSATF QEGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126180.0CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615013.10.0PREDICTED: cyclic dof factor 1
TrEMBLA0A0E0GN100.0A0A0E0GN10_ORYNI; Uncharacterized protein
TrEMBLB8BGR50.0B8BGR5_ORYSI; Uncharacterized protein
STRINGBGIOSGA031952-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.25e-46cycling DOF factor 2